Download free
brown lioness on green grass during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

brown lioness on green grass during daytime

Download this free HD photo of brown, wildlife, lion, and animal in Kenya by Sneha Cecil (@sneha_snaps)

A map markerMaasai Mara National Reserve, Kenya
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5200
SafetyFree to use under the Unsplash License
Brown backgroundswildlifeLion imagesAnimals images & picturesafricasleepymasaimaasailionesssafarisavannahfliesyawnmaasai maraHd yellow wallpapersCute images & picturesFunny images & picturesmammaljaguarpantherPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Animal Poses
45 images · Curated by Simone Stander
Animals images & picturesmammalpet