Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of canada, nb, fredericton, and uptown fredericton in Fredericton, Canada by Conor Hennessy (@conorhennessy_)

A map markerUptown Fredericton, Fredericton, NB, Canada
Calendar outlinedPublished on CameraGoogle, Pixel 3a
SafetyFree to use under the Unsplash License
canadanbfrederictonuptown frederictonroadfreewayhighwaytarmacasphaltvehicletransportationCar images & picturesautomobilePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Social History
80 images · Curated by Unsplash Archive
protestunited statecrowd
School
390 images · Curated by Sarah Mischnick
schoolescuelaeducación