Download free
people walking on street between buildings during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

people walking on street between buildings during daytime

Download this free HD photo of collioure, france, Street, and alley in Collioure, France by Jametlene Reskp (@reskp)

A map markerCollioure, France
Calendar outlinedPublished on CameraCanon, EOS 7D Mark II
SafetyFree to use under the Unsplash License
colliourefranceStreetalleyfrance streetBrown backgroundspathwalkwaysidewalkpavementbuildingtownurbanHd city wallpapersroadflagstonecobblestonemetropolisalleywayoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Vast Terrain
36 images · Curated by Kaeli Ellis
outdoorHd grey wallpapersman
Sweet Tooth
123 images · Curated by Isaiah Nathanael
sweetdessertFood images & pictures