Download free
a black and white photo of a building with a steeple
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a black and white photo of a building with a steeple

Download this free HD photo of city wandering, noirphotography, vintagestyle, and classicfilm by Yves Cedric Schulze (@yvced)

Calendar outlinedPublished on CameraFujifilm eSystems, Inc., Digital Link
SafetyFree to use under the Unsplash License
city wanderingnoirphotographyvintagestyleclassicfilmfilmnoirmonochromeblackandwhitephotographycity life vibesstreet photographercity view photographycity explorercity sightsstreet view photographycity life scenescity discoveriesurban photographycontrastphotographygrainyfilmretrophotographymoodymonochromePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Architecture
40 images · Curated by Naoufal Kadhom
architecturebuildingHd windows wallpapers
Computer
39 images · Curated by Anand Houston
Hd computer wallpapersworkoffice