Download free
a crowd of people standing around a firework display
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Feelings Images › Cool Images & Photos

a crowd of people standing around a firework display

Download this free HD photo of new year, langkawi, kedah, and malaysia in Langkawi, Malaysia by Eirik Skarstein (@eskarstein)

A map markerLangkawi, Kedah, Malaysia
Calendar outlinedPublished on CameraLEICA CAMERA AG, LEICA Q2
SafetyFree to use under the Unsplash License
Hd new year wallpaperslangkawikedahmalaysiaurbanhumanconcertPeople images & picturescrowdadultmalemanmobile phonecell phoneHd city wallpaperstownnight lifebaghandbagFlag images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Blossoms Bloom
256 images · Curated by Ioana M
bloomblossomFlower images
DETAILS
625 images · Curated by Rada Kuyanova
detailHd white wallpapersHd grey wallpapers
Abstract Landscape/Nature
105 images · Curated by Sharon _ _ _ _ _ _ _
buildingplantoutdoor