Unsplash logo
Avatar of user Getty Images
Unsplash+
In collaboration with Getty Images
A lockDownload
Baby elephant crossing a dirt track in a park in Tanzania
1,000,000+ Free Images › Feelings Images › Cute Images & Pictures

Baby elephant crossing a dirt track in a park in Tanzania

Download this HD photo of cute, animal, elephant, and animal trunk by Getty Images (@gettyimages)

Calendar outlinedPublished on SafetyLicensed under the Unsplash+ License
Cute images & picturesAnimals images & picturesElephant images & picturesanimal trunkserengeti national parkgray colorwalkingcalfsavannahwildernesssafarianimal wildlifeanimals in the wildsmallyoung animalafricatravel destinationsenvironmentafrican elephantwildlifePublic domain images