Download free
bridge near city buildings during nighttime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

bridge near city buildings during nighttime

Download this free HD photo of new york, brooklyn bridge, city, and building in New York, United States by Luca Bravo (@lucabravo)

A map markerBrooklyn Bridge, New York, United States
Calendar outlinedPublished on CameraLeica Camera AG, LEICA M10
SafetyFree to use under the Unsplash License
New york pictures & imagesbrooklyn bridgeHd city wallpapersbuildingurbanbridgenewyorkwalkdowntownnightlifemegacityrivertrafficskylinelibraryroominterior designindoorstownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Desktop Wallpaper
131 images · Curated by Amanda Harris
stadtgebäudeWolkenkratzer
NY
19 images · Curated by Julie Stickelmann
nyNew york pictures & imagesville