Download free
city building during night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

city building during night

Download this free HD photo of long exposure, sunset, cars, and freeway in Atlanta, United States by Joey Kyber (@jtkyber1)

A map markerJackson Street Bridge, Atlanta, United States
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
long exposureSunset images & picturesCar images & picturesfreewayCloud pictures & imagesroadwaynighttimeskyscrapperskyscrappersoutsideexteriordrivenight nightlifebustlehighway interstateHd neon wallpapersheadlightscity lightsfastshutterPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Atlanta
5 images · Curated by Melissa Steele
atlantumbuildingdowntown
White paper
22 images · Curated by Axel Seminor
Hq background imagesHd wallpapersbuilding
Long Exposures
11 images · Curated by Ken Saro-Wiwa Fofana
long exposureoutdoordusk