Download free
grayscale photo of woman in black jacket walking on hallway
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

grayscale photo of woman in black jacket walking on hallway

Download this free HD photo of grey, road, building, and city by Mehdi Najjar (@__mehdi_najjar__)

Calendar outlinedPublished on CameraNORITSU KOKI, QSS-32_33
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadbuildingHd city wallpapersurbantownStreetcorridorHd brick wallpapersPeople images & pictureshumanwallalleywayalleypathwalkwayprisonhandrailbanisterPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Devices
58 images · Curated by Maria Scarzella Thorpe
deviceHd computer wallpaperswork