Download free
landscape photography of mountain
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

landscape photography of mountain

Roosevelt Mountain view

A map markerRoosevelt, United States
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7000
SafetyFree to use under the Unsplash License
rooseveltunited statesMountain images & picturesCloud pictures & imagesHd grey wallpapersHd sky wallpaperscumuluslakeLandscape images & picturesmountain rangeHd amazing wallpapersBeautiful pictures & imagesawe-inspiringdaytimeadventureNature imagesoutdoorsalpsweatherHd scenery wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Nature
162 images · Curated by Gudrun Jakobsson
Nature imagesHd grey wallpapersoutdoor
Homeschool
64 images · Curated by Denise Thomas
homeschoolHd kids wallpaperschild