Download free
men riding motorcycle
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

men riding motorcycle

Download this free HD photo of paris, франция, road, and path in Париж, Франция by Dmitriy Nushtaev (@nushtaev_dmitriy)

A map markerParis, Франция
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5100
SafetyFree to use under the Unsplash License
Paris pictures & imagesфранцияroadpathwalkwaysidewalkpavementcobblestonePeople images & pictureshumantarmacasphaltHd city wallpaperstownbuildingurbanmetropolisvehicletransportationMotorcycle pictures & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wanderlust
199 images · Curated by Unsplash Archive
wanderlustoutdoorPeople images & pictures
in your mind
342 images · Curated by Elke Karin Lugert
grigiostradatrasporto