Download free
high angle photography of vehicles passing on street surrounded with city buildings
ā€“ ā€“ā€“ ā€“ā€“ā€“ā€“
ā€“ā€“ā€“ ā€“ ā€“ā€“ā€“ ā€“ ā€“
ā€“ ā€“ā€“ ā€“ā€“ā€“ā€“
ā€“ā€“ā€“ ā€“ ā€“ā€“ā€“ ā€“ ā€“

Featured in

Editorial, Street Photography
1,000,000+ Free Images ā€ŗ Feelings Images ā€ŗ Cool Images & Photos

high angle photography of vehicles passing on street surrounded with city buildings

Download this free HD photo of london, grey, united kingdom, and road in London, United Kingdom by Mavis CW (@mavis)

A map markerLondon, United Kingdom
Calendar outlinedPublished on CameraApple, iPhone
SafetyFree to use under the Unsplash License
londonHd grey wallpapersunited kingdomroadtrafficcitylifebusskylineskyscraperrivervehicleferris wheelarchitecturetransportationyachtwatercraftvesseltownshipaerial viewPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

bl
55 images Ā· Curated by Agnieszka Grabowicz
blPeople images & pictureshuman
London
110 images Ā· Curated by Claudia Rosen
londonbuildingunited kingdom
London
7 images Ā· Curated by Karen Kelly
londonbuildingunited kingdom