Unsplash logo
Avatar of user Getty Images
Unsplash+
In collaboration with Getty Images
A lockDownload
People partying at a concert and enjoying live music

People partying at a concert and enjoying live music

Download this HD photo of music festival, cheering, fan - enthusiast, and arm by Getty Images (@gettyimages)

Calendar outlinedPublished on SafetyLicensed under the Unsplash+ License
music festivalcheeringfan - enthusiastarmdjaudiencestage - performance spacehappinessadultphotographymennightlifevitalitynightlight - natural phenomenonhorizontalin silhouetteserbiasmoke - physical structurejoyPublic domain images

From this series

Plus sign for Unsplash+
People enjoying festival and dancing to live music

Related collections

Fans
4 images · Curated by Unsplash Plus
rt-fanyoung adultstage - performance space
Convention
6 images · Curated by Unsplash Plus
rt-conventionPeople images & picturescrowd
Epsom
1 image · Curated by Zaaman
epsomconcertyoung adult