Download free
red and white concrete building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red and white concrete building

Downtown during the quarantine.

A map markerEdmonton, AB, Canada
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5300
SafetyFree to use under the Unsplash License
downtownHd city wallpapersurbanarchitectureroadintersectionbuildingtowntransportationautomobileCar images & picturesmetropolishumanPeople images & picturespedestrianoffice buildingtarmacasphaltfreewayhigh risePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Invest Alberta
131 images · Curated by Tiffany Chin
albertumoutdoorcanada
Edmonton, Alberta
81 images · Curated by lex goose
albertumedmontonbuilding
Edmonton
16 images · Curated by Blue Cunningham
edmontonbuildingcanada