Download free
red and white tram on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red and white tram on road during daytime

Download this free HD photo of česko, praha 1, prague, and historic in Česko by Kateřina Jeřábková (@katerina_jerabkova)

A map markerMalostranské náměstí, Malá Strana, Praha 1, Česko
Calendar outlinedPublished on CameraCanon, EOS 1200D
SafetyFree to use under the Unsplash License
českopraha 1praguehistorictramwaytrafficvehicletraincable carstreetcarHd city wallpapersmetropolisurbantownrailwayrailneighborhoodtraffic lightautomobileCar images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Posed & Poised
77 images · Curated by Rebecca Matthews
Vintage backgroundsHd grey wallpapersplant
Landscape
1,430 images · Curated by Carlo Cardella
Landscape images & picturesHd wallpapersoutdoor