Download free
time lapse photography of cars on road during night time
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

time lapse photography of cars on road during night time

Prague summer night amazing long exposure lights

Calendar outlinedPublished on CameraCanon, EOS R
SafetyFree to use under the Unsplash License
urbanHd city wallpapersnightczechnight roadcity at nightcity landscapepraguelong exposurecityscapeLight backgroundsHd dark wallpapersroadhighwayfreewaytarmacasphaltpathbuildingtownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

City/Street
2,605 images · Curated by Nick Nice
streetHd city wallpapersbuilding
ROAD
661 images · Curated by Isla MA
roadoutdoorgravel