Download free
white and brown concrete building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white and brown concrete building

Download this free HD photo of norge, bergen, walkway, and path in Bergen, Norge by Tomas Eidsvold (@eidsvold)

A map markerBergen, Norge
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
norgebergenwalkwaypathpavementsidewalkcobblestonehumanPeople images & picturesflagstonebuildingspiretowerarchitecturesteeplePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Urban Exploration
230 images · Curated by Alex Holyoake
costruzionecittàurbano