Avatar of user Teodora Popa Photographer
Teodora Popa Photographer
My name is Teodora, Iโ€™m 23 years old, I have a passion for photography for more than 10 years. I would like to be known for my work in this domain Instagram:https://www.instagram.com/teodorapopaphotographer/ FOLLOW ME for MORE photo :) !
A checkmark inside of a circleAvailable for hire
PayPal iconSupport via PayPal
A map markerCluj-Napoca
Interests
portraitLandscape images & pictures
a woman in a red shirt and black skirt
Download
a woman leaning against a wall talking on a cell phone
Download
a woman in a white shirt and black pants
Download
a woman in a white shirt leaning on a fence
Download
a woman in a red sweater is talking on a cell phone
Download
a woman in a red top and black skirt
Download
a woman with a ponytail standing next to a stone wall
Download
a woman wearing a white jacket and a black shirt
Download
a woman is posing for a picture with her hands on her head
Download
a woman in a white shirt is posing for a picture
Download
a woman wearing a white jacket holding her hand up
Download
a woman with long brown hair wearing a white shirt
Download
a woman with her hand on her face
Download
a person with red hair
Download
a woman holding a guitar
Download
a person wearing a hat and holding the hand up
Download
a woman in a red dress leaning against a wall
Download
a woman in a red dress leaning against a wall
Download
a woman in a red dress posing for a picture
Download
a woman in a red dress and a tiara
Download
a woman in a red shirt and black skirt
a woman in a white shirt and black pants
a woman in a red top and black skirt
a woman wearing a white jacket and a black shirt
a woman in a white shirt is posing for a picture
a woman with long brown hair wearing a white shirt
a person with red hair
a woman holding a guitar
a woman in a red dress leaning against a wall
a woman in a red dress posing for a picture
a woman leaning against a wall talking on a cell phone
a woman in a white shirt leaning on a fence
a woman in a red sweater is talking on a cell phone
a woman with a ponytail standing next to a stone wall
a woman is posing for a picture with her hands on her head
a woman wearing a white jacket holding her hand up
a woman with her hand on her face
a person wearing a hat and holding the hand up
a woman in a red dress leaning against a wall
a woman in a red dress and a tiara
a woman in a red shirt and black skirt
a woman in a white shirt leaning on a fence
a woman with a ponytail standing next to a stone wall
a woman wearing a white jacket holding her hand up
a person with red hair
a woman in a red dress leaning against a wall
a woman in a red dress and a tiara
a woman leaning against a wall talking on a cell phone
a woman in a red sweater is talking on a cell phone
a woman wearing a white jacket and a black shirt
a woman in a white shirt is posing for a picture
a woman with her hand on her face
a woman in a red dress leaning against a wall
a woman in a white shirt and black pants
a woman in a red top and black skirt
a woman is posing for a picture with her hands on her head
a woman with long brown hair wearing a white shirt
a woman holding a guitar
a person wearing a hat and holding the hand up
a woman in a red dress posing for a picture

Teodora's work appears in the following categories

portraitTree images & picturesHd wallpapersHq background imagesroadplantHd grey wallpapersfloralakefogvehicleCar images & picturesyellow lineHd forest wallpaperscanadaHd phone wallpapersTravel imageshighwaygravelfreewaydirt roadconiferovercoatvibeSummer images & picturessmiley faceromaniancoataccessoryrobe
Unsplash logo

Make something awesome